Align Glutamate/aspartate import permease protein GltJ (characterized)
to candidate WP_011650724.1 RL_RS05130 amino acid ABC transporter permease
Query= SwissProt::P0AER3 (246 letters) >NCBI__GCF_000009265.1:WP_011650724.1 Length = 290 Score = 101 bits (251), Expect = 2e-26 Identities = 66/223 (29%), Positives = 112/223 (50%), Gaps = 3/223 (1%) Query: 25 IWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTW 84 I G +T+ L+ A + ++G ++ T N L + +V FR VPLIVQ F W Sbjct: 63 ILRGVLLTLELTAGAMMFGIVLGCLLALMATSQNPVLKVIAAGFVWWFRGVPLIVQIFFW 122 Query: 85 YLVIPELLPEKIGMW-FKAELDPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKN 143 + + L ++GM F ++ + L+ L LGL AA + E +R + ++ RGQ+ Sbjct: 123 FNIA--LFIPQVGMGSFTISINDLVTPALAGFLALGLHEAANMSEIIRGGLIAVDRGQRE 180 Query: 144 AALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLD 203 AA A+GL Q + V++P A R+IVPP ++ + ++K SAI S IG+ D+ QA + Sbjct: 181 AATALGLKKTQTFFTVIMPQATRIIVPPTGNQAIGMLKASAIVSVIGMQDLLTQAQAIYA 240 Query: 204 YSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLPGNMGGK 246 + E ++ Y+ I + + +E+ + G K Sbjct: 241 RNFLVIELLFVASIWYLAITSVASIGQHYLEKSLVPKGRTAEK 283 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 290 Length adjustment: 25 Effective length of query: 221 Effective length of database: 265 Effective search space: 58565 Effective search space used: 58565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory