Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_011649487.1 RL_RS41085 amino acid ABC transporter permease/ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_000009265.1:WP_011649487.1 Length = 511 Score = 187 bits (476), Expect = 4e-52 Identities = 107/228 (46%), Positives = 140/228 (61%), Gaps = 4/228 (1%) Query: 17 EIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEG 76 ++ L+ L+I AG + +IG SG+GKSTLLR +NRL EP GG IL++GE + A+ E Sbjct: 286 DLDVLKGVDLDIAAGTVTCIIGPSGSGKSTLLRCMNRLVEPKGGDILLDGESILAMKPER 345 Query: 77 LRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHAR 136 LRR RVGM+FQHFNL T +N+ + L R E LA VGL++ Sbjct: 346 LRR---RVGMVFQHFNLFPDHTALENVMLSLTKIKKMPRQEARRIAEARLAEVGLAERRD 402 Query: 137 KYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIV 196 PA LSGGQ+QRV IARALA P I+L DE TSALDP+ VL L+A + R+ +T+ Sbjct: 403 HRPAGLSGGQQQRVAIARALAMDPEIMLFDEVTSALDPELVKGVLDLMAALGRQ-GMTMA 461 Query: 197 LITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFVFE 244 ++THEM RRV DQV MD G IVE G +F +P+ +RF+ E Sbjct: 462 VVTHEMGFARRVADQVVFMDEGRIVEAGCPQQIFDNPKSERLKRFLAE 509 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 511 Length adjustment: 31 Effective length of query: 304 Effective length of database: 480 Effective search space: 145920 Effective search space used: 145920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory