Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized)
to candidate WP_011654450.1 RL_RS29540 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02120 (384 letters) >NCBI__GCF_000009265.1:WP_011654450.1 Length = 252 Score = 119 bits (299), Expect = 7e-32 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 7/215 (3%) Query: 167 YVETPLWGGLMVTLVLSFVGIAVSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLIT 226 Y PL GGL TL+LS + IA++ P+ IL AL R S P+++ T + RGVPL+ Sbjct: 21 YPNGPL-GGLANTLILSALSIALAFPVSILFALARLSRSPLLRWPVTALVYFTRGVPLLM 79 Query: 227 VLFMASVMLPLFLPQGVTFDKFLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLG 286 ++ + ++PL G F+ L + ++ SA+++EVVR G+ A+ GQ + +LG Sbjct: 80 LILWSYFLVPLLT--GADVPSFVTMLTTLVVYQSAFLSEVVRAGIVALGPGQMDAGRALG 137 Query: 287 LSFWQKMGFIVLPQALKLVIPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWAT 346 S+ M FI+LPQAL +IP I++TF+ KDT+L +I + DL S N Sbjct: 138 HSYIGAMRFIILPQALYNMIPSIISTFVSTIKDTTLGYVINVPDL----TFAASQVNNQL 193 Query: 347 AVTPLTGLIFAGFVFWLFCFGMSRYSGFMERLLDR 381 P + V++ C+ ++ ++ +ER + R Sbjct: 194 LTQPFQVFLILAIVYFAICWTLTYFANRLERSITR 228 Lambda K H 0.329 0.144 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 252 Length adjustment: 27 Effective length of query: 357 Effective length of database: 225 Effective search space: 80325 Effective search space used: 80325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory