Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate WP_011652369.1 RL_RS14695 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A0D9B2B6 (307 letters) >NCBI__GCF_000009265.1:WP_011652369.1 Length = 294 Score = 171 bits (432), Expect = 2e-47 Identities = 107/305 (35%), Positives = 175/305 (57%), Gaps = 18/305 (5%) Query: 7 FFQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIAI-AGLAMMGL 65 F Q L++GL GS YAL AIG+T+++ +NFA GE M+ ++ +A+ AGL M Sbjct: 4 FLQVLMSGLATGSIYALAAIGFTLLWQAAQTVNFAQGEFVMLPAFFMLMALGAGLPM--- 60 Query: 66 DSVPLLMTAAFIASIVVTSSYGYSIERIAYRPLRGSNR---LIPLISAIGMSIFLQNTVL 122 PL + A AS+ V GY +R+ P++ S L +I+ + ++I L+ +V Sbjct: 61 ---PLAILVALAASVFVL---GYLFKRLIVEPMQASKAGGGLPLVIATMALAILLKESVK 114 Query: 123 LSQDSKDKSIPNLIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRLGRA 182 ++ + P L+ G G +IS I ++L ++ LTLF++R+R GRA Sbjct: 115 EFYGAEAQPFPELVSG----GSLNVFGAVISVTDIAHLFISLAVVVALTLFLNRTRTGRA 170 Query: 183 CRACAEDIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGLKAF 242 +A A++ +A +LG++T ++ TF+I AALA++A+ L++ Y N +L GL AF Sbjct: 171 MQATAQNPNVAEILGVDTRRMVLYTFLINAALASLASFLITPFYLAKFSNGEYL-GLIAF 229 Query: 243 TAAVLGGIGSIPGAMLGGLVLGVAEAFGADIFGDQYKDVVAFGLLVLVLLFRPTGILGRP 302 AA++GG I GA++GGL++GV + A +Y+ V LL++++L+RP G+LG P Sbjct: 230 IAAIVGGFNQIRGALVGGLLIGVLDNMTATYVTAEYRAAVPLVLLIVIILWRPEGLLGTP 289 Query: 303 EVEKV 307 E KV Sbjct: 290 EGRKV 294 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 294 Length adjustment: 27 Effective length of query: 280 Effective length of database: 267 Effective search space: 74760 Effective search space used: 74760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory