Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011652367.1 RL_RS14685 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000009265.1:WP_011652367.1 Length = 248 Score = 187 bits (474), Expect = 2e-52 Identities = 100/252 (39%), Positives = 150/252 (59%), Gaps = 7/252 (2%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 N VL V ISK FGG+QA+ DV + +G+V GLIGPNG+GK+T FN + G PD G Sbjct: 2 NPSVLSVRNISKTFGGIQAVKDVSFEVMKGEVLGLIGPNGSGKSTLFNCVLGQLRPDRGE 61 Query: 66 FELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 + G ++AK G+ RTFQ + +F +MT L+N+++ G+ L ++ Sbjct: 62 VFVNGHAVAGMKACDLAKRGVGRTFQQLSVFPDMTVLDNIILAGQEHQGTML------SR 115 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 F +A + ++A++L+D+ + + KA LSYG Q+ L+ A A P L+ LDEPA Sbjct: 116 LFGKPDAGLTQQAEQLVDFFKLRHLKEDKAGALSYGQQKLLDAAMAFMAGPDLVLLDEPA 175 Query: 186 AGMNATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 G+N T L+E + D + T ++IEH+++ VM LC R+ VL G IAEG P E+ Sbjct: 176 GGVNLTMLGNLKERLQTYNRDHDTTFVVIEHNMEFVMSLCTRIIVLAEGAIIAEGAPDEI 235 Query: 245 QKNEKVIEAYLG 256 + N++VI+AYLG Sbjct: 236 RANQQVIDAYLG 247 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 248 Length adjustment: 24 Effective length of query: 236 Effective length of database: 224 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory