Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_011649778.1 RL_RS27140 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000009265.1:WP_011649778.1 Length = 240 Score = 176 bits (445), Expect = 5e-49 Identities = 98/237 (41%), Positives = 151/237 (63%), Gaps = 6/237 (2%) Query: 9 TPLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGK 68 T LL ++ + +GY + +L GV+F ++ G ++++G NGAGK+TL TI G+ T H+G Sbjct: 2 TALLRIDRLVSGY-GEARVLGGVSFELDEGRSLSLLGRNGAGKTTLVDTIVGVTTHHSGT 60 Query: 69 ITFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKIFA 128 I+F G ++ + + G+ +VPQ N+F SL+VEENL A S++ ++++ Sbjct: 61 ISFAGVDLTRTRPERRAAAGIGWVPQERNIFRSLTVEENLTAIARPGPWSVE----RVYS 116 Query: 129 MFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQ 188 MFPRL +RR R LSGGE+QMLA+G+ALML P LL+LDEP L+PI+V ++ +++ Sbjct: 117 MFPRLKERRFNRGNQLSGGEQQMLALGRALMLNPRLLLLDEPLEGLAPIIVDELLAALRK 176 Query: 189 -INQEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLGAG 244 I+ EG + I++EQ ARK L + DR VLE G + +G LL D ++ + YL G Sbjct: 177 IIDGEGMSAIIIEQKARKILPLTDRTVVLERGLVSYAGESAPLLADSEIFDRYLALG 233 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 240 Length adjustment: 23 Effective length of query: 224 Effective length of database: 217 Effective search space: 48608 Effective search space used: 48608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory