Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_011654139.1 RL_RS27810 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000009265.1:WP_011654139.1 Length = 410 Score = 432 bits (1110), Expect = e-125 Identities = 225/393 (57%), Positives = 289/393 (73%), Gaps = 3/393 (0%) Query: 4 KLEVKNLYKIFGEHPQRAFKYIEKGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLS 63 K+ +KN+YK+FGEHP++AF + G +K +I TG S+GV DAS I GEIFVIMGLS Sbjct: 17 KISLKNIYKVFGEHPKKAFALLRAGKTKSEIHAATGCSIGVNDASFDIRAGEIFVIMGLS 76 Query: 64 GSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTV 123 GSGKST++RLLNRLIEP+ G + IDG DI +S +EL +RR+ I+MVFQS AL+P+ TV Sbjct: 77 GSGKSTLLRLLNRLIEPSSGSIEIDGRDITGMSRSELIALRRRDISMVFQSVALLPNRTV 136 Query: 124 LDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINP 183 L+N AFG+E+AG+ R++KAL AL+ VGL+ YA + PD+LSGGM+QRVGLARALA P Sbjct: 137 LNNAAFGLEVAGVGEAGRKQKALAALKAVGLDGYADSRPDQLSGGMKQRVGLARALASEP 196 Query: 184 DILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEV 243 ILLMDEAFSALDPLIRTEMQDELV+LQ++H RTIVF+SHDLDEAMRIGDRI IMQNG V Sbjct: 197 TILLMDEAFSALDPLIRTEMQDELVRLQSEHSRTIVFVSHDLDEAMRIGDRICIMQNGNV 256 Query: 244 VQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRSPVGLIRKTPGFGPRSALKLL 303 VQVG PDEI+ PANDYVR+FFR VD++ VF A D+AR+S V +I + G +AL+ + Sbjct: 257 VQVGAPDEIVTQPANDYVRSFFRNVDVAHVFKAGDVARKSQVTIIER-EGVSAAAALERM 315 Query: 304 QDEDREYGYVIERGNKFVGVVSIDSL--KAALSQAQGIEAALIDDPLVVDAQTPLSELLS 361 ++ DREY ++ R + G++S SL K A A + + + A PLS +L Sbjct: 316 KNYDREYAIILGRDKTYHGMISQTSLIEKMRAKAADPYRGAFLTEIQAIPASEPLSNVLG 375 Query: 362 HVGQAPCAVPVVDEEHQYVGIISKRMLLQALDR 394 V +P VPVV + ++Y+G ISK LL+ LDR Sbjct: 376 KVAASPWPVPVVCDRNRYIGSISKSALLETLDR 408 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 410 Length adjustment: 31 Effective length of query: 369 Effective length of database: 379 Effective search space: 139851 Effective search space used: 139851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory