Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011652368.1 RL_RS14690 branched-chain amino acid ABC transporter permease
Query= TCDB::P21628 (417 letters) >NCBI__GCF_000009265.1:WP_011652368.1 Length = 337 Score = 164 bits (415), Expect = 4e-45 Identities = 101/287 (35%), Positives = 161/287 (56%), Gaps = 13/287 (4%) Query: 121 LIYVMLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYALLAEYAGFGFWTALPIAGMMAALF 180 LIY + +GLN+ +G AG + L F AVGAY AL+ G + A+P++ + Sbjct: 37 LIYTIAAMGLNLTLGYAGQISLAQASFMAVGAYITALMT-MNGIHWLIAMPVSVAACFVI 95 Query: 181 GFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTEITGGPNGIGSIPKPTLFGLTFERR 240 G L+GFP LR++G +LA VTL F ++ ++LRN +TGG G ++P+P + F+ Sbjct: 96 GLLVGFPALRVKGHFLAFVTLAFNTLLVLVLRNEDWLTGGSYGKSNMPRPDFW--VFDT- 152 Query: 241 APEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVINRLMRMPIGRAWEALREDEV 300 GM++ I +N K+ L +V ++ L ++ L+R P GRA++ LRE+ + Sbjct: 153 ---GMKS--TVLSIPLTSNQKMYYLCLVVFVIFALLMY---GLVRSPWGRAFKGLRENPI 204 Query: 301 ACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTPESFTFIESAMILAIVVLGGM 360 +LGL+ + L AF IG++ G AGS + + P SF S IL +VV+GG Sbjct: 205 RAESLGLDIRRITLLAFAIGSAAGGLAGSLVSPVVQYIEPNSFALSFSLKILLMVVVGGS 264 Query: 361 GSQLGVILAAVVMVLLQEMRGFNE-YRMLIFGLTMIVMMIWRPQGLL 406 G G +L A V++LL E F E Y ++I+ +I++M++ P GL+ Sbjct: 265 GYFFGPMLGAAVVILLPEFLRFTEGYYLIIYSALVILLMVFSPSGLM 311 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 337 Length adjustment: 30 Effective length of query: 387 Effective length of database: 307 Effective search space: 118809 Effective search space used: 118809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory