Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate WP_011654261.1 RL_RS41060 amino acid ABC transporter permease/ATP-binding protein
Query= uniprot:P70970 (276 letters) >NCBI__GCF_000009265.1:WP_011654261.1 Length = 591 Score = 138 bits (348), Expect = 2e-37 Identities = 89/226 (39%), Positives = 135/226 (59%), Gaps = 14/226 (6%) Query: 10 LYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKN----- 64 L D++ S+ GS A++G +GSGKSTLL+ +N L + +G IS+ + +K Sbjct: 358 LDDVDLSLPAGSVTAILGPSGSGKSTLLRAINHLERVDEGFISVDGDFVGYNRKGDTLYE 417 Query: 65 ---KDLKKLRKKVGIVFQFPEHQLFEE-TVLKDISFGPMNF-GVKKEDAEQKAREMLQLV 119 KD+ K R +G+VFQ LF TVL+++ P+ GV +EDA Q A+E+L + Sbjct: 418 LKEKDILKRRADIGMVFQ--SFNLFPHLTVLENLIEAPIQVRGVGREDAVQLAQELLARI 475 Query: 120 GLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELH 179 GLS+++ + P +LSGGQ +RVAIA LA+ P+VL+ DEPT+ LDP E++D+ EL Sbjct: 476 GLSDKI-NAYPRQLSGGQQQRVAIARALALRPKVLLFDEPTSALDPELVGEVLDVIKELA 534 Query: 180 QRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGE 225 + G T ++VTH + A AD ++ M G I +G P +F + E Sbjct: 535 RTGT-TLVIVTHEVGFAREVADTVVFMDSGRILEAGPPARIFAQAE 579 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 591 Length adjustment: 31 Effective length of query: 245 Effective length of database: 560 Effective search space: 137200 Effective search space used: 137200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory