Align ABC transporter permease (characterized, see rationale)
to candidate WP_011652369.1 RL_RS14695 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KC95 (309 letters) >NCBI__GCF_000009265.1:WP_011652369.1 Length = 294 Score = 154 bits (390), Expect = 2e-42 Identities = 95/305 (31%), Positives = 165/305 (54%), Gaps = 21/305 (6%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGA 60 M LQ +++GL GS+YAL A+G+T+++ Q +NFA GE +M+ A +G Sbjct: 1 MQQFLQVLMSGLATGSIYALAAIGFTLLWQAAQTVNFAQGEFVMLPAFFMLMALGA---- 56 Query: 61 MPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPR---LAPLITAIGMSILLQT 117 G P + +L+A + V L ++ +++ P+++S L +I + ++ILL+ Sbjct: 57 --GLPMPLAILVALAASVFV---LGYLFKRLIVEPMQASKAGGGLPLVIATMALAILLKE 111 Query: 118 LAMIIWKPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAM 177 + +P+P ++ + GA I+ T I L ++ + +L +N T GRAM Sbjct: 112 SVKEFYGAEAQPFPELVSGGSLNVFGAVISVTDIAHLFISLAVVVALTLFLNRTRTGRAM 171 Query: 178 RATAENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFT 237 +ATA+NP VA ++GV ++ TF+I A LA++A + Y A+ + G GL AF Sbjct: 172 QATAQNPNVAEILGVDTRRMVLYTFLINAALASLASFLITPFY-LAKFSNGEYLGLIAFI 230 Query: 238 AAVFGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRP 297 AA+ GG + GA+VGG+L+G+++ + + Y+ + Y ++LI+I+ RP Sbjct: 231 AAIVGGFNQIRGALVGGLLIGVLDNMTATYV--------TAEYRAAVPLVLLIVIILWRP 282 Query: 298 SGLLG 302 GLLG Sbjct: 283 EGLLG 287 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 294 Length adjustment: 27 Effective length of query: 282 Effective length of database: 267 Effective search space: 75294 Effective search space used: 75294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory