Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_011653012.1 RL_RS18225 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >NCBI__GCF_000009265.1:WP_011653012.1 Length = 367 Score = 173 bits (439), Expect = 6e-48 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 14/368 (3%) Query: 8 TVVAAIAAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGK 67 T+ A + A+ A + IG +AP++G A YG +NGA+ A++E+N +G +G + Sbjct: 5 TLTATLVASLAFAPLAHADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILG-E 63 Query: 68 KIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGA 127 K+ EL DDA +PKQG +AA K+ + VVG + SG IP S V + G+ VT Sbjct: 64 KVVLELA--DDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPT 121 Query: 128 ATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKK 187 AT P+LTK G R D+ A Y + K K VAI++D+ AYG+G+AD FK Sbjct: 122 ATAPDLTKRGLTNVLRTCGRDDQQAEVAAKYVLKNFKDKRVAIVNDKGAYGKGLADAFKA 181 Query: 188 TATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGN 247 T A G+ V T DF A+ T IK++ D +++GG P+GG + RQ+ L N Sbjct: 182 TLNAGGITEVVNDAITPGDKDFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDLA-AN 240 Query: 248 VKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYPNQF--Q 305 GGDG+ +E A G G I S K P KA DA + Sbjct: 241 ATIIGGDGLSNTEF--WAIGTDAAGGTIFT-NASDATKSPDS---KAAADALAAKNIPAE 294 Query: 306 VYSPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTS--TIAFEPNGEMKNPAIT 363 ++ Y A ++ +++A S + K + T+ + + G++ + + + Sbjct: 295 AFTLNAYAAVEVLKAGIEKAGSAEDAEAVATALKDGKEIPTAIGKVTYGETGDLTSQSFS 354 Query: 364 LYVYKDGK 371 LY ++ GK Sbjct: 355 LYKWEAGK 362 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 367 Length adjustment: 30 Effective length of query: 345 Effective length of database: 337 Effective search space: 116265 Effective search space used: 116265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory