Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_042444409.1 AZL_RS21100 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein
Query= BRENDA::D3RXI0 (252 letters) >NCBI__GCF_000010725.1:WP_042444409.1 Length = 715 Score = 73.6 bits (179), Expect = 1e-17 Identities = 55/178 (30%), Positives = 85/178 (47%), Gaps = 7/178 (3%) Query: 11 DERVARIKIANPPVNVLDMETMKEIISAIDEV---EGVDVIVFSGEGKSFSAGAEIKEH- 66 +E VA I + +PPVN L + + +A+ V IV +G G+ F G +I E Sbjct: 7 NEGVAVITLDHPPVNALALALRTRLGAALHAALRDVSVRAIVLAGAGRGFCGGGDITEFD 66 Query: 67 FPDKAPEMIRWFTQLIDKVLRCKAITVAAVKGFALGGGFELAIACDFVLASKNAKLGVPE 126 P E L + VAA+ G ALGGG ELA+AC +A ++G+PE Sbjct: 67 LPAVCQEPTP--ATLFSLIENSPKPVVAALHGMALGGGLELALACHARVAEARTQVGLPE 124 Query: 127 ITLAHYPPV-AIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKVFEDENFEESV 183 + L P LPR++G++ A LI+ G A+ + GL +++ + E +V Sbjct: 125 VHLGLVPGAGGTQRLPRLVGFELALNLIVQGRTQPAQSLRDSGLFDRLTDGSPVEAAV 182 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 715 Length adjustment: 32 Effective length of query: 220 Effective length of database: 683 Effective search space: 150260 Effective search space used: 150260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory