Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_086935522.1 AZL_RS31490 ATP-binding cassette domain-containing protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000010725.1:WP_086935522.1 Length = 291 Score = 476 bits (1226), Expect = e-139 Identities = 240/286 (83%), Positives = 255/286 (89%), Gaps = 5/286 (1%) Query: 10 PLLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLT 69 PLL+VEHLTMRFGGLVA NDVSF A GEITA+IGPNGAGKTTLFNC+TGFYTPTVGRLT Sbjct: 6 PLLSVEHLTMRFGGLVANNDVSFEARAGEITALIGPNGAGKTTLFNCVTGFYTPTVGRLT 65 Query: 70 LRHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSI 129 LRH GKEFLLERMPGYRI+Q A VARTFQNIRLFGGMSVLENLIVAQHNKL+RASGF+I Sbjct: 66 LRHPAGKEFLLERMPGYRIAQLAGVARTFQNIRLFGGMSVLENLIVAQHNKLMRASGFAI 125 Query: 130 AGLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVM 189 AGLLGLP + R E EAV+LAKYWLDRVRL EFADWEAGNLPYGAQRRLEIARAMCTEPV+ Sbjct: 126 AGLLGLPGFRRAEHEAVELAKYWLDRVRLTEFADWEAGNLPYGAQRRLEIARAMCTEPVL 185 Query: 190 LCLDEPAAGLNPRESGELADLLTYIRD-----EHKIGVLLIEHDMSVVMTISDHVVVLDY 244 LCLDEPAAGLNPRESGELA++LT+IRD H+ GVLLIEHDMSVVM ISDHVVVLDY Sbjct: 186 LCLDEPAAGLNPRESGELAEILTFIRDVRTPRGHRTGVLLIEHDMSVVMRISDHVVVLDY 245 Query: 245 GRKISDGDPAFVKNDPAVIRAYLGEEEDEELPPEIKADLPEVAKRA 290 GRKISDG P VKNDPAVIRAYLGE+EDE LPPE+ ADL K A Sbjct: 246 GRKISDGTPEHVKNDPAVIRAYLGEDEDEALPPEVAADLNLARKGA 291 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 291 Length adjustment: 26 Effective length of query: 268 Effective length of database: 265 Effective search space: 71020 Effective search space used: 71020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory