Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_012976936.1 AZL_RS23495 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000010725.1:WP_012976936.1 Length = 249 Score = 187 bits (475), Expect = 2e-52 Identities = 105/238 (44%), Positives = 145/238 (60%), Gaps = 6/238 (2%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL V D+ Y + L + + G++VTVIGPNGAGK+TL I G+L PS+G + Sbjct: 5 LLEVSDLCVSY-GKIEALSNASLRVGEGQIVTVIGPNGAGKTTLLSAIMGVL-PSRGRVS 62 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKD----RI 119 F G +V RGM VP+ +F +++V +NL +G F ++ +D + Sbjct: 63 FLGREGRSPAIQDMVARGMSLVPEKRALFATMSVEDNLRLGGFRFHARSRREQDAAMEEL 122 Query: 120 YTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQI 179 Y +FP+L +RR Q A TLSGGERQMLA+ RALM P LL+LDEPS L+P++V++VF I Sbjct: 123 YALFPRLKERRGQMAATLSGGERQMLALARALMGKPKLLMLDEPSLGLAPLIVREVFRII 182 Query: 180 KAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGAA 237 + G +I+L+EQNA+ AL +AD YVLE GR +EG L +DP V YLG A Sbjct: 183 AELRRGGVSILLIEQNARAALRVADHAYVLELGRIAMEGPAAELAHDPRVVAAYLGMA 240 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 249 Length adjustment: 24 Effective length of query: 216 Effective length of database: 225 Effective search space: 48600 Effective search space used: 48600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory