Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_012976503.1 AZL_RS21160 enoyl-CoA hydratase-related protein
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000010725.1:WP_012976503.1 Length = 269 Score = 150 bits (380), Expect = 2e-41 Identities = 87/245 (35%), Positives = 135/245 (55%), Gaps = 11/245 (4%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQFNQLTPA 76 I L+RP N ++ ++ + + DP++RVI++ +G+ F +G +I F + Sbjct: 32 IVLHRPP-FNIVSMLQRDQFSAVFAALDRDPKVRVIVLRAEGENFSSGGNIAGFME---- 86 Query: 77 EAWKFSKKGREIMDKI---EALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPE 133 K ++ E+ I E KP IA + GY G G EL+LACD R+ +E AQ LPE Sbjct: 87 ---KSAEHVSELAVNIAAPERCRKPVIAQVRGYCFGVGFELSLACDFRVVSETAQFALPE 143 Query: 134 INLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRK 193 + +G+ PG GG+ RL +IG R +M+M RIPG+ A +G V V A LE Sbjct: 144 MRIGMIPGSGGSARLLHMIGICRTKDMVMRAKRIPGRQAADWGFVTECVADAELEATVAA 203 Query: 194 LAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKRE 253 L +++ SP++ IK V+N G + + + +E +G + +ED KEGV++F EKR+ Sbjct: 204 LVDELRGFSPLAQRTIKGVLNSGNNVSVNGAIEIEGQAYGRLRGSEDFKEGVASFHEKRK 263 Query: 254 PTFKG 258 P FKG Sbjct: 264 PVFKG 268 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 269 Length adjustment: 25 Effective length of query: 234 Effective length of database: 244 Effective search space: 57096 Effective search space used: 57096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory