Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_012977791.1 AZL_RS28135 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase PaaG
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000010725.1:WP_012977791.1 Length = 264 Score = 156 bits (394), Expect = 5e-43 Identities = 91/247 (36%), Positives = 133/247 (53%), Gaps = 4/247 (1%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQF----NQ 72 ITLNRPD+LN+ + EEL A++ +D +R +++TG G+ FCAG D++ Q Sbjct: 18 ITLNRPDRLNSFTTAMHEELRAALAVVRADSSVRCLLLTGAGRGFCAGQDLSDRAVAPGQ 77 Query: 73 LTPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLP 132 P ++ + L P + +NG A G G LALACDI +AA A Sbjct: 78 EAPDLGASIETNYNPLVRCLRELPMPVVCAVNGVAAGAGANLALACDIVLAARSASFIQA 137 Query: 133 EINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETR 192 +G+ P GGT L R++G RA+ + M GD+IP + AE +G++ + V L +E Sbjct: 138 FCKIGLIPDSGGTWTLPRLVGHARAMGLAMLGDKIPAERAEAWGMIWKAVDDDKLAEEAG 197 Query: 193 KLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKR 252 LA ++A + LALIK +N LD+ L S L LE + D EGV+AF+ KR Sbjct: 198 ALARQLATQPTHGLALIKRALNVSLDNDLDSQLDLERDLQREAGRSRDYLEGVAAFVAKR 257 Query: 253 EPTFKGK 259 PTF+G+ Sbjct: 258 PPTFEGR 264 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 264 Length adjustment: 25 Effective length of query: 234 Effective length of database: 239 Effective search space: 55926 Effective search space used: 55926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory