Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_042444094.1 AZL_RS16590 enoyl-CoA hydratase/isomerase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2193 (272 letters) >NCBI__GCF_000010725.1:WP_042444094.1 Length = 260 Score = 230 bits (587), Expect = 2e-65 Identities = 123/249 (49%), Positives = 166/249 (66%) Query: 15 GVATLWLSRESKNNAFNAEMIRELILALDHVSSDPNLRFLLIRGRGKHFSAGADLAWMQQ 74 GVAT+ ++R +NAFN ++I +L A + DP +R +L+RG GK FSAGADL+WM++ Sbjct: 12 GVATVTMNRGDVHNAFNEQVIADLTSAFRRLGEDPAVRVVLLRGVGKSFSAGADLSWMKR 71 Query: 75 SAELDYHTNLDDARELAELMYNLAKLKIPTLAVVQGAAFGGALGLISACDMAIGADEAQF 134 A + NL DA LA ++ L + PT+AVVQG AFGG +GL+SACD+AIG + A F Sbjct: 72 MAGYSHAENLADALGLATMLRTLDECPKPTVAVVQGPAFGGGVGLVSACDIAIGVETATF 131 Query: 135 CLSEVRIGLAPAVISPFVVQAIGERAARRYALTAERFDGQRAKEIGLLSESYPAEVLDQQ 194 LSEVR+G+ PA ISP+V+ AIGERA RRY LT ERF A IGLL E A L++ Sbjct: 132 ALSEVRLGIIPAAISPYVIAAIGERACRRYFLTGERFGAAEAHRIGLLHELTNAGGLEEA 191 Query: 195 VEQWIDNLLLNSPAAMRASKELLREVGNGALTPALRRYTENAIARIRVSPEGQEGLRAFL 254 V + + L+ ++P A+ A+KEL+R V LT + R T IAR R S EG+EG+ AFL Sbjct: 192 VARTVRTLMDSAPTAVTAAKELIRAVARRPLTEEVMRDTAERIARQRASAEGKEGVGAFL 251 Query: 255 QKRAPNWQA 263 KR P+W++ Sbjct: 252 DKRTPSWRS 260 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 260 Length adjustment: 25 Effective length of query: 247 Effective length of database: 235 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory