Align BadK (characterized)
to candidate WP_012977791.1 AZL_RS28135 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase PaaG
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000010725.1:WP_012977791.1 Length = 264 Score = 158 bits (399), Expect = 1e-43 Identities = 96/258 (37%), Positives = 139/258 (53%), Gaps = 5/258 (1%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGA 65 IL + V ITLNRPD LN+ A+ + L AL AD + +++ G R F AG Sbjct: 7 ILLDIADGVATITLNRPDRLNSFTTAMHEELRAALAVVRADSSVRCLLLTGAGRGFCAGQ 66 Query: 66 DIASMAAWSYSDV--YGSNFITRNWETIRQIRK---PVLAAVAGLAYGGGCELALACDIV 120 D++ A + G++ T +R +R+ PV+ AV G+A G G LALACDIV Sbjct: 67 DLSDRAVAPGQEAPDLGASIETNYNPLVRCLRELPMPVVCAVNGVAAGAGANLALACDIV 126 Query: 121 IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV 180 +A RSA F K+GL+P +GGT LPR +G A+AM + + + AE A+ +G++ + Sbjct: 127 LAARSASFIQAFCKIGLIPDSGGTWTLPRLVGHARAMGLAMLGDKIPAERAEAWGMIWKA 186 Query: 181 VDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADA 240 VDDD+L +E ALA +A L +K +LN + ++ L + ER S D Sbjct: 187 VDDDKLAEEAGALARQLATQPTHGLALIKRALNVSLDNDLDSQLDLERDLQREAGRSRDY 246 Query: 241 REGIQAFLEKRAPCFSHR 258 EG+ AF+ KR P F R Sbjct: 247 LEGVAAFVAKRPPTFEGR 264 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 264 Length adjustment: 25 Effective length of query: 233 Effective length of database: 239 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory