Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_012975022.1 AZL_RS13095 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_000010725.1:WP_012975022.1 Length = 291 Score = 185 bits (470), Expect = 1e-51 Identities = 102/304 (33%), Positives = 177/304 (58%), Gaps = 19/304 (6%) Query: 5 IQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGL 64 +Q +++GL +G++YAL LG++++Y ++INFA G+ +M+G M +L A G+ Sbjct: 6 LQYLLSGLTIGAIYALAGLGFSIIYNASHVINFAQGEFIMIGGMASATL------TASGV 59 Query: 65 PGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMIWG 124 P + ++I GA+ +V +L+ + A R+A + +I IG SI L+ +A ++WG Sbjct: 60 PLPLAILIGCGGAM----LVGVLVAKFAVERARDASTVTLIIITIGASIFLRGVAELVWG 115 Query: 125 RSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAENP 184 + P+ GA + P + ++ A + +V + L KT G+A+ AT+ N Sbjct: 116 KDFKRLDAFSGETPIQFLGASMQPQSLWVVGTAGVLIVAIGLFFAKTLTGKAILATSHNR 175 Query: 185 RIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLGGI 244 A L+G+D +V++ +FA+ A L A+ G + A + + MG + GLK F+AAVLGG+ Sbjct: 176 LAAQLVGIDVKRVVLASFALSAALGAVGGAV-VAPITFSYTEMGIMLGLKGFTAAVLGGL 234 Query: 245 GNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIMGER 304 G+ GA+ GG+++G+ E+LGAGYI S Y+D AF++++ VL P+G+ G+R Sbjct: 235 GHGPGAVAGGLIVGVAEALGAGYI--------SSAYKDAVAFVIILAVLLFMPNGLFGKR 286 Query: 305 VADR 308 +R Sbjct: 287 GTER 290 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 291 Length adjustment: 27 Effective length of query: 282 Effective length of database: 264 Effective search space: 74448 Effective search space used: 74448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory