Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_012976936.1 AZL_RS23495 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000010725.1:WP_012976936.1 Length = 249 Score = 222 bits (566), Expect = 5e-63 Identities = 114/241 (47%), Positives = 165/241 (68%), Gaps = 5/241 (2%) Query: 1 MTTNILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRV 60 M+ +L+V L V+YG I+A+ L V EG++VT+IG NGAGKTT L AI G LP+ Sbjct: 1 MSAPLLEVSDLCVSYGKIEALSNASLRVGEGQIVTVIGPNGAGKTTLLSAIMGVLPS--- 57 Query: 61 EGHIEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAAD- 119 G + +LG+ + ++V +++VPE R +F MS+++NL +G + + + D Sbjct: 58 RGRVSFLGREGRSPAIQDMVARGMSLVPEKRALFATMSVEDNLRLGGFRFHARSRREQDA 117 Query: 120 -IDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEK 178 +++ +A+FPRLKER QMA TLSGGE+QMLA+ARALM PKLL+LDEPS+GL+P++V + Sbjct: 118 AMEELYALFPRLKERRGQMAATLSGGERQMLALARALMGKPKLLMLDEPSLGLAPLIVRE 177 Query: 179 IFEVIRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYL 238 +F +I + G++ILL+EQNA+ AL A YV+E G I M+G A ++ DPRV AAYL Sbjct: 178 VFRIIAELRRGGVSILLIEQNARAALRVADHAYVLELGRIAMEGPAAELAHDPRVVAAYL 237 Query: 239 G 239 G Sbjct: 238 G 238 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 249 Length adjustment: 24 Effective length of query: 217 Effective length of database: 225 Effective search space: 48825 Effective search space used: 48825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory