Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_086935522.1 AZL_RS31490 ATP-binding cassette domain-containing protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000010725.1:WP_086935522.1 Length = 291 Score = 268 bits (685), Expect = 9e-77 Identities = 142/266 (53%), Positives = 190/266 (71%), Gaps = 14/266 (5%) Query: 3 RPILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLI 62 +P+L V LTMRFGGL+A N V+ + ++ ++IGPNGAGKTT+FNC+TGFY PT G + Sbjct: 5 KPLLSVEHLTMRFGGLVANNDVSFEARAGEITALIGPNGAGKTTLFNCVTGFYTPTVGRL 64 Query: 63 RLD---GEE--IQGLPGHKIAR-KGVVRTFQNVRLFKEMTAVENLLVAQHRHLN--TNF- 113 L G+E ++ +PG++IA+ GV RTFQN+RLF M+ +ENL+VAQH L + F Sbjct: 65 TLRHPAGKEFLLERMPGYRIAQLAGVARTFQNIRLFGGMSVLENLIVAQHNKLMRASGFA 124 Query: 114 LAGLFKTPAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPR 173 +AGL P FRR+E EA+E A +WL+ V LTEFA+ AG L YG QRRLEIAR M T P Sbjct: 125 IAGLLGLPGFRRAEHEAVELAKYWLDRVRLTEFADWEAGNLPYGAQRRLEIARAMCTEPV 184 Query: 174 ILMLDEPAAGLNPKETDDLKALIAKLRS-----EHNVTVLLIEHDMKLVMSISDHIVVIN 228 +L LDEPAAGLNP+E+ +L ++ +R H VLLIEHDM +VM ISDH+VV++ Sbjct: 185 LLCLDEPAAGLNPRESGELAEILTFIRDVRTPRGHRTGVLLIEHDMSVVMRISDHVVVLD 244 Query: 229 QGAPLADGTPEQIRDNPDVIKAYLGE 254 G ++DGTPE ++++P VI+AYLGE Sbjct: 245 YGRKISDGTPEHVKNDPAVIRAYLGE 270 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 291 Length adjustment: 25 Effective length of query: 230 Effective length of database: 266 Effective search space: 61180 Effective search space used: 61180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory