Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_012975565.1 AZL_RS16120 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000010725.1:WP_012975565.1 Length = 242 Score = 231 bits (588), Expect = 1e-65 Identities = 109/235 (46%), Positives = 172/235 (73%), Gaps = 3/235 (1%) Query: 1 MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60 +L D+++++YG +Q D+S+EV +G+IV L+G N +GKST + + G + SG + + Sbjct: 5 LLRLDRINSFYGPVQVHFDLSLEVPRGQIVCLLGGNASGKSTSMKVILGLLKPRSGEVVF 64 Query: 61 EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDK--VLE 118 +G+ L GL + I+R+ I VPE RR+F +TV EN+ MG + T D + V D +L+ Sbjct: 65 DGQSLSGLTTPQIVRRGIGSVPESRRLFGTMTVRENVLMGAY-TRSDAHAVAEDYEGILD 123 Query: 119 LFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQ 178 LFP+L+ER+ Q+AGT+SGGEQQM+A+ RALM +P+L+++DEP++GL+P+ + ++ E+I+ Sbjct: 124 LFPKLRERHAQQAGTLSGGEQQMVAMARALMGRPRLIVMDEPTMGLSPLHVDRVLEMIQT 183 Query: 179 LRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG 233 + R+GV++F+VEQNAN AL++A R YVL+ GRIV+ A L +P++RDAYLGG Sbjct: 184 INRQGVSIFMVEQNANLALQIAHRGYVLQTGRIVLSGAAADLARDPQIRDAYLGG 238 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 242 Length adjustment: 23 Effective length of query: 210 Effective length of database: 219 Effective search space: 45990 Effective search space used: 45990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory