Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate WP_042445294.1 AZL_RS22090 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Query= metacyc::MONOMER-11683 (330 letters) >NCBI__GCF_000010725.1:WP_042445294.1 Length = 317 Score = 181 bits (458), Expect = 3e-50 Identities = 117/316 (37%), Positives = 171/316 (54%), Gaps = 10/316 (3%) Query: 18 DMYRTMLLARKIDERMWLLNRSGKI--PFVISCQGQEAAQVGAAFALDREMDYVLPYYRD 75 D+YR M L R+ DER + ++G++ P+ C GQEA G + L R+ DY+ YR Sbjct: 3 DIYRRMALIRRNDERFRSVIKAGRLVMPYYSPC-GQEAIPSGVSVLL-RDSDYICTIYRG 60 Query: 76 MGVVLAFGMTAKDLM--MSGFAKAADPNSGGRQMPGHFGQKKNRIVTGSSPVTTQVPHAV 133 + +LA G+ L M+G GG P H ++ ++ + V + +P A Sbjct: 61 VHDMLAKGVPMPALWAEMAGRITGTCKGKGG---PMHITHPESGVMVTTGIVGSSMPIAN 117 Query: 134 GIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISVPYDK 193 G+ALA ++ +D A FG+G+SN G FHE N A+V KLP IF+C+NN YA Y Sbjct: 118 GLALAAQVRGEDRVAVAYFGDGASNIGAFHESLNLASVWKLPAIFVCQNNGYAEHTKYAA 177 Query: 194 QVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYRLTPHS 253 + NI++RA YG+PGVTV+GNDPL +Y A EA ERAR G GPTLIE ++R H Sbjct: 178 GTSVANIAERAAAYGIPGVTVDGNDPLAIYAAAHEAVERARSGGGPTLIEAKTFRFHGHV 237 Query: 254 SDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNEATDEAE 313 D D SY E A +DP+ ++ L G+ S+ + EI ++EA + A Sbjct: 238 FGDAD-SYMDPAEKAAAMAADPVPAFRTRLIADGVASEAELAAIETEIDRKIDEAVEFAL 296 Query: 314 NAPYAAPESALDYVYA 329 ++P+ E ++A Sbjct: 297 SSPFPGVEELRRDIFA 312 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 317 Length adjustment: 28 Effective length of query: 302 Effective length of database: 289 Effective search space: 87278 Effective search space used: 87278 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory