Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate WP_148219579.1 AZL_RS21685 2-oxo acid dehydrogenase subunit E2
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3542 (425 letters) >NCBI__GCF_000010725.1:WP_148219579.1 Length = 254 Score = 132 bits (331), Expect = 2e-35 Identities = 85/247 (34%), Positives = 135/247 (54%), Gaps = 6/247 (2%) Query: 179 QSNASAPVAAA-YAQRTDEQQIPVIGMRRKIAQRMQDATQRAAHFSYVEEIDVTAVEELR 237 +S+A+AP ++ + + +P+ ++ + + H ++ ++ D+T +E LR Sbjct: 8 KSSAAAPTPQFDFSVYGEVETVPLTRLQILAGAALTRNSVAIPHVTHHDDADITELEALR 67 Query: 238 AHLNEKHGATRGKLTLLPFLVRALVVALRDFPQINARYDDEAQVITRLGAVHVGIATQAD 297 L E A K+T L FL++ + L+ +P+ NA D + + +++GIA Sbjct: 68 RRLAEDDSAV--KITPLIFLIKGVAAVLKAYPRFNASLDPSGKQLILKKYINIGIAIDTP 125 Query: 298 IGLMVPVVRHAEARSLWDSAAEISRLATAARNGKASRDELSGSTITLTSLGALGGIVSTP 357 GL+V VVR + + + AAE++ L+ AR E+SG T++SLG LGG TP Sbjct: 126 NGLLVGVVRDCDRKGWRELAAEVATLSAKAREKGLPLAEMSGGCFTISSLGGLGGTGFTP 185 Query: 358 VLNLPEVAIVGV--NKIVERPMVIKGQIVIRKMMNLSSSFDHRVVDGMDAALFIQAIRGL 415 ++N PEVAI+GV N+ V RP G I R M+ LS S+DHRV++G DAA F + L Sbjct: 186 IINAPEVAILGVGRNRPVPRPDE-TGGIDWRTMLPLSLSYDHRVINGADAARFTSHLAAL 244 Query: 416 LEQPATL 422 L PATL Sbjct: 245 LADPATL 251 Lambda K H 0.318 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 254 Length adjustment: 28 Effective length of query: 397 Effective length of database: 226 Effective search space: 89722 Effective search space used: 89722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory