Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_042446206.1 AZL_RS29470 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000010725.1:WP_042446206.1 Length = 300 Score = 365 bits (937), Expect = e-106 Identities = 188/300 (62%), Positives = 232/300 (77%), Gaps = 9/300 (3%) Query: 1 MMSPVTNT--MSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFN 58 M +P+ N SD LL VEHL+M+FGGL+A ND SFEA+ G+ITALIGPNGAGKTT+FN Sbjct: 1 MSAPMDNAGMNSDKPLLSVEHLTMRFGGLVANNDVSFEARAGEITALIGPNGAGKTTLFN 60 Query: 59 CITGFYKPTMGMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLV 118 C+TGFY PT+G +T +GK++LLER+P +RI + A VARTFQNIRLF G++VLENL+V Sbjct: 61 CVTGFYTPTVGRLTLRHPAGKEFLLERMPGYRIAQLAGVARTFQNIRLFGGMSVLENLIV 120 Query: 119 AQHNKLMKASGYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQR 178 AQHNKLM+ASG+ I GL+G+ ++R EA+ELA++WL++ L + AD AG+LPYGAQR Sbjct: 121 AQHNKLMRASGFAIAGLLGLPGFRRAEHEAVELAKYWLDRVRLTEFADWEAGNLPYGAQR 180 Query: 179 RLEIARAMCTGPELLCLDEPAAGLNPRESATLNALL---KSIRAETG--TSILLIEHDMS 233 RLEIARAMCT P LLCLDEPAAGLNPRES L +L + +R G T +LLIEHDMS Sbjct: 181 RLEIARAMCTEPVLLCLDEPAAGLNPRESGELAEILTFIRDVRTPRGHRTGVLLIEHDMS 240 Query: 234 VVMEISDHVVVLEYGQKISDGTPDHVKNDPRVIAAYLGVEDEEV--EEVIAAVEQLEGGA 291 VVM ISDHVVVL+YG+KISDG P+HVKNDP VI AYLG +++E EV A + GA Sbjct: 241 VVMRISDHVVVLDYGRKISDGNPEHVKNDPAVIRAYLGEDEDEALPPEVAADLNLARKGA 300 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 300 Length adjustment: 26 Effective length of query: 266 Effective length of database: 274 Effective search space: 72884 Effective search space used: 72884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory