Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_010936196.1 DET_RS02295 amino acid ABC transporter permease
Query= TCDB::Q52665 (434 letters) >NCBI__GCF_000011905.1:WP_010936196.1 Length = 273 Score = 107 bits (267), Expect = 4e-28 Identities = 76/252 (30%), Positives = 132/252 (52%), Gaps = 30/252 (11%) Query: 196 FWLYAAAPIEAALQSALPLALPEVDSDQFG----GFLLALVIGVTAIVVSLPLGILLALG 251 +WL A + L L L P+ D F G + +++ V + + L LG+ ALG Sbjct: 28 WWLVAGVFV---LTGGLMLFQPDPFLDIFKYVWVGIGITVLVAVVSYFLMLILGMFGALG 84 Query: 252 RQSDMLIVKSLSVGIIEFVRGVPLITLL----FTASLLLQYFLPPGTNF--------DLI 299 R S I++ L+ +E VRG+PL+ L F +++Q + G NF + I Sbjct: 85 RLSKNTILRGLATFYVEIVRGIPLLVQLIWWYFAFPVIIQS-IGQGLNFGPMMNYQANPI 143 Query: 300 LRVVILVTLFAAAYIAEVIRGGLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPG 359 + + +T AY++E+ R G+ ++P+GQ EAA +LG+ + QA R +I+PQAL++ +P Sbjct: 144 VMAIWGMTFCYGAYMSEIYRAGIQSIPKGQMEAARSLGMSHTQAMRYVILPQALRVVLPP 203 Query: 360 IVSSFIGLFKDTTLVAFVGLFDPLKGISNVVRSDMAWKGTYWEP---YIFVALIFFLFNF 416 + + FI L KDT+LV+ V ++++VR + T + P + + L++ + Sbjct: 204 MGNEFIALLKDTSLVSTV-------AVADMVRLGREFTATNFNPIEVWTMIGLLYLILTL 256 Query: 417 SMSRYSMYLERK 428 SR Y+E+K Sbjct: 257 LSSRLINYIEKK 268 Lambda K H 0.329 0.143 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 273 Length adjustment: 29 Effective length of query: 405 Effective length of database: 244 Effective search space: 98820 Effective search space used: 98820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory