Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_010936195.1 DET_RS02290 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000011905.1:WP_010936195.1 Length = 253 Score = 291 bits (745), Expect = 9e-84 Identities = 153/244 (62%), Positives = 188/244 (77%), Gaps = 1/244 (0%) Query: 18 SDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSG 77 +++ I+I + K +G+ LR ++L + RGE +VI GPSGSGKST++RCINRLEE+ SG Sbjct: 8 AEQPIIKIENVQKHFGRVKALRGVSLDIKRGEVVVIIGPSGSGKSTLLRCINRLEEYDSG 67 Query: 78 KIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEET 137 KI VDGI L S +NI+ VR EVGMVFQ FNLF HL +++N+TLA VRK K EA E Sbjct: 68 KITVDGIPLDST-ENINHVRREVGMVFQSFNLFSHLKVIDNITLAQCQVRKRTKEEAAEI 126 Query: 138 AMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVL 197 A L+KV IP++A +P QLSGGQQQRVAIAR+L M P+IMLFDEPTSALDPEMIKEVL Sbjct: 127 AADLLKKVGIPDKAHAFPVQLSGGQQQRVAIARALAMNPQIMLFDEPTSALDPEMIKEVL 186 Query: 198 DTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFL 257 D M LA+EGMTM+ V+HEMGFA+A A+RVIFM +G IVE P +FF NP+ ERTK FL Sbjct: 187 DVMTTLAKEGMTMVVVSHEMGFARAAADRVIFMDEGLIVESAAPDEFFTNPKHERTKLFL 246 Query: 258 SQIL 261 S+IL Sbjct: 247 SKIL 250 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 253 Length adjustment: 24 Effective length of query: 239 Effective length of database: 229 Effective search space: 54731 Effective search space used: 54731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory