Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_010936195.1 DET_RS02290 amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF2754 (331 letters) >NCBI__GCF_000011905.1:WP_010936195.1 Length = 253 Score = 150 bits (380), Expect = 2e-41 Identities = 87/235 (37%), Positives = 139/235 (59%), Gaps = 5/235 (2%) Query: 4 LQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEISIG 63 +++ NV K FG V+ L+ ++L ++ GE VV +GPSG GKSTLLR I+ LE+ +G+I++ Sbjct: 13 IKIENVQKHFGRVKALRGVSLDIKRGEVVVIIGPSGSGKSTLLRCINRLEEYDSGKITVD 72 Query: 64 GQTVTTTP---PAKRGIAMVFQSYALYPHLSVRENMALALKQER-QPKEEIAARVAEASR 119 G + +T +R + MVFQS+ L+ HL V +N+ LA Q R + KEE A A+ + Sbjct: 73 GIPLDSTENINHVRREVGMVFQSFNLFSHLKVIDNITLAQCQVRKRTKEEAAEIAADLLK 132 Query: 120 MLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARL 179 + + D P +LSGGQ+QRVAI RA+ P++ LFDEP S LD + + L++ Sbjct: 133 KVGIPDKAHAFPVQLSGGQQQRVAIARALAMNPQIMLFDEPTSALDPEM-IKEVLDVMTT 191 Query: 180 HRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFI 234 + +M+ V+H+ A AD+++ + +G I + P E + NP + F+ Sbjct: 192 LAKEGMTMVVVSHEMGFARAAADRVIFMDEGLIVESAAPDEFFTNPKHERTKLFL 246 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 253 Length adjustment: 26 Effective length of query: 305 Effective length of database: 227 Effective search space: 69235 Effective search space used: 69235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory