Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_010936851.1 DET_RS08420 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_000011905.1:WP_010936851.1 Length = 368 Score = 146 bits (369), Expect = 7e-40 Identities = 82/226 (36%), Positives = 128/226 (56%), Gaps = 11/226 (4%) Query: 35 LKGIDLDVK---DGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDGVEVGH------ 85 L G DL+V D + +GPSG GK+ L+ +AGL G + ++G + Sbjct: 10 LPGFDLEVAFSADSGIMAMLGPSGSGKTMTLQCVAGLTQVDEGYINLNGEVLLDTSRKID 69 Query: 86 VAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLEPYLAR 145 + P R + VFQ+YAL+PHLTV+DN+ G++ + KAE + + + + + R Sbjct: 70 IRPQVRRVGFVFQNYALFPHLTVRDNIAYGIRH--LEKAESDGIITRLMENMHIASLGHR 127 Query: 146 RPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLKATMIY 205 P++LS GQ+QRVA+ RAI EP++ L DEP S LDA ++ + +E+ L + K +I Sbjct: 128 FPSQLSAGQQQRVALARAIAPEPRVLLLDEPFSALDAVVKESLEIELLSLQQFYKGIIIL 187 Query: 206 VTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIG 251 VTH+ E ++ K+ + +GRI Q G ++ PANL VAG +G Sbjct: 188 VTHNFAEGYRMSSKMAIYESGRIAQCGDKGKIVGSPANLTVAGLMG 233 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 368 Length adjustment: 29 Effective length of query: 323 Effective length of database: 339 Effective search space: 109497 Effective search space used: 109497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory