Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_010936645.1 DET_RS04900 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000011905.1:WP_010936645.1 Length = 263 Score = 184 bits (466), Expect = 2e-51 Identities = 102/239 (42%), Positives = 147/239 (61%), Gaps = 7/239 (2%) Query: 11 LLQVNGVE-TYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICG-----SPQAR 64 +L+VN +E TY I+ L GV + V + IV+L+G NGAGK+T + I G Sbjct: 1 MLKVNNIEVTYLNVIKVLHGVSLEVPEKSIVALLGGNGAGKTTTLKAISGLLHIEEGLVT 60 Query: 65 TGSVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGA-GLDNLKHFAEDV 123 G++ ++G I + I +L I Q+ EGR +F +T ENL +GA + ++ D+ Sbjct: 61 DGNIEWDGTRIDKKNPEAIGKLGIVQALEGRHVFEHLTTEENLIVGAFNRKDRQNIKSDL 120 Query: 124 EKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIF 183 ++ FPRL+ G LSGGEQQML IGRA+MARPKL++LDEPSLGLAPL+VK IF Sbjct: 121 AMVYEYFPRLRHVQHNTAGYLSGGEQQMLVIGRAMMARPKLMMLDEPSLGLAPLMVKEIF 180 Query: 184 EAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 I++ NE +G +V LVEQN AL ++H YV+ NG++ + G L+ N +V+ Y+ Sbjct: 181 GIIKRFNEEQGTSVLLVEQNVKVALSIAHYGYVLENGRIVLDGDTSFLINNEDVKEFYM 239 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 263 Length adjustment: 24 Effective length of query: 223 Effective length of database: 239 Effective search space: 53297 Effective search space used: 53297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory