Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate WP_010936196.1 DET_RS02295 amino acid ABC transporter permease
Query= uniprot:B2TBJ7 (240 letters) >NCBI__GCF_000011905.1:WP_010936196.1 Length = 273 Score = 114 bits (286), Expect = 2e-30 Identities = 67/213 (31%), Positives = 117/213 (54%), Gaps = 9/213 (4%) Query: 16 GVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYTTVFRGVPELLVIY 75 G+ +L A+++ L L + +FGAL +LS+ LR + Y + RG+P L+ + Sbjct: 61 GITVLVAVVSYFLML----ILGMFGAL---GRLSKNTILRGLATFYVEIVRGIPLLVQLI 113 Query: 76 LFYFGGSTLVTSVGQ--LFGAEGFVGVPPFVVGALAVGMISGAYQAEVYRSAVLAVSRGE 133 +YF ++ S+GQ FG P V+ + GAY +E+YR+ + ++ +G+ Sbjct: 114 WWYFAFPVIIQSIGQGLNFGPMMNYQANPIVMAIWGMTFCYGAYMSEIYRAGIQSIPKGQ 173 Query: 134 LEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISVTGLAELLRTSQVA 193 +EAARS+GM R +++PQ LR LP +GN + LKD++L+S +A+++R + Sbjct: 174 MEAARSLGMSHTQAMRYVILPQALRVVLPPMGNEFIALLKDTSLVSTVAVADMVRLGREF 233 Query: 194 AGSTHQYFTFFVVGGALYLIMTSISNRVFNRAE 226 + + + G LYLI+T +S+R+ N E Sbjct: 234 TATNFNPIEVWTMIGLLYLILTLLSSRLINYIE 266 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 273 Length adjustment: 24 Effective length of query: 216 Effective length of database: 249 Effective search space: 53784 Effective search space used: 53784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory