Align glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_011373513.1 SUDEN_RS09855 aldehyde dehydrogenase family protein
Query= BRENDA::Q88RC0 (480 letters) >NCBI__GCF_000012965.1:WP_011373513.1 Length = 471 Score = 249 bits (635), Expect = 2e-70 Identities = 152/456 (33%), Positives = 238/456 (52%), Gaps = 10/456 (2%) Query: 29 KVTNPATGEVIGTVPKMGTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQD 88 K NP GEV + ++A+ A A T +R + L + +N++ Sbjct: 19 KRVNPYNGEVASEFVTCNADDAKKALNIALLASKEASKTTIAQRCSWLLDVASKLAQNKE 78 Query: 89 DLARLMTTEQGKPLAEAKGEIAYAASFIEWFAEEAKRIYGDTI--PGHQPDKRLIVI--K 144 D+A+ +T E GKP+ ++ E+ + AE + ++G+T+ K+ I + Sbjct: 79 DIAKTITDEVGKPITYSRIEVERCIETVTLAAETMRTMHGETVNTDAFASGKKTISFFSR 138 Query: 145 QPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPA- 203 P GV AITP+NFP +I K PAL AG ++LKP + P +A +L + Sbjct: 139 VPCGVVVAITPFNFPLNLIAHKIAPALVAGNAVILKPTPEAPLTAYKFAKLFIESEFAIK 198 Query: 204 GVLSVVTGSAGEVGGELTGNSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFI 263 LSVV G A +VGG L + + R +SFTGS +G + + IKKVSLELGGNA Sbjct: 199 DALSVVYGDA-DVGGTLVTSEIPRVISFTGSVGVGEIITKSAG--IKKVSLELGGNAATF 255 Query: 264 VFDDADLDKAVEGAIISKYRNNGQTCVCANRIYVQDGVYDAFAEKLAAAVAKLKIGNGLE 323 + A+LD A + I + N+GQ C+ RIYV +Y FA K+A A KL +G+ E Sbjct: 256 IDKSANLDLAAQRCAIGAFVNSGQVCISLQRIYVHKDIYSEFALKIAEATKKLVVGSPYE 315 Query: 324 EGTTTGPLIDGKAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKE 383 E T GPL++ +A + E ++ A+ +GA + + +EG F P ++ DV + A+ + Sbjct: 316 EDTFMGPLVNDEAAKRAMEWVQSAIKEGATPILEPR-VEGRVFYPCVMADVKEDMAIVCQ 374 Query: 384 ETFGPLAPLFRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGIN-TGL 442 E F P+ L KD E + M N++ +GL + D++ R L+ G + IN Sbjct: 375 EVFAPIVSLIEVKDFDEALPMMNNSPYGLQFSIFTNDLNLTKRAINELDAGGIVINDMPT 434 Query: 443 ISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCI 478 + ++ P+GG+K SG+GREG ++ IE+ EIK + I Sbjct: 435 LRFDIQPYGGVKLSGVGREGPRFAIEEMSEIKSVII 470 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 471 Length adjustment: 33 Effective length of query: 447 Effective length of database: 438 Effective search space: 195786 Effective search space used: 195786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory