Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_011373231.1 SUDEN_RS08390 3-oxoacyl-ACP reductase FabG
Query= BRENDA::A0A075B5H4 (258 letters) >NCBI__GCF_000012965.1:WP_011373231.1 Length = 248 Score = 103 bits (258), Expect = 3e-27 Identities = 79/248 (31%), Positives = 117/248 (47%), Gaps = 8/248 (3%) Query: 7 GKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADI 66 GK +L+TGS+ GIG A LA YG V +N + + + GG A D+ Sbjct: 5 GKNVLVTGSSRGIGAEIAKVLAGYGLKVWINYRSGATEADAIKDAIESNGGRAAVIGFDV 64 Query: 67 TKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTK 126 + + V+ + L+NNAG + L + F V++ N S + + Sbjct: 65 SSEEAFVDAIKTIVDCDGELSYLVNNAGITNDKLALRMKSEDFMS-VINANLLSCFVGCR 123 Query: 127 FAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDS 186 A+ +R K SG+ V++ SI E G G Y+ASK + + +++ E Sbjct: 124 EAMKVMRK--KKSGS---VVNIASIVG-ETGNAGQTNYSASKGGVIAMTKSFALEAASSG 177 Query: 187 IRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITG 246 IR+N + PG + T SDE+K + IPMGRFG E+A A F S +S YITG Sbjct: 178 IRYNTITPGFIATEMTDVLSDEIKGSFTSKIPMGRFGNPSEIAEATAFLLSDHSS-YITG 236 Query: 247 QILDVNGG 254 + L VNGG Sbjct: 237 ETLKVNGG 244 Lambda K H 0.320 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 248 Length adjustment: 24 Effective length of query: 234 Effective length of database: 224 Effective search space: 52416 Effective search space used: 52416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory