Align Lactaldehyde dehydrogenase; EC 1.2.1.22 (uncharacterized)
to candidate WP_011373513.1 SUDEN_RS09855 aldehyde dehydrogenase family protein
Query= curated2:A6UVT6 (465 letters) >NCBI__GCF_000012965.1:WP_011373513.1 Length = 471 Score = 333 bits (853), Expect = 1e-95 Identities = 181/453 (39%), Positives = 276/453 (60%), Gaps = 11/453 (2%) Query: 17 NPYNNEIIGYIPSLSRNETKEAIKIAEEHKSTMKNLSPTIRYNILMKIASELSKNKRELA 76 NPYN E+ + + ++ K+A+ IA + R + L+ +AS+L++NK ++A Sbjct: 22 NPYNGEVASEFVTCNADDAKKALNIALLASKEASKTTIAQRCSWLLDVASKLAQNKEDIA 81 Query: 77 KLITIDVGKPIKQSIIEVDRTITTFKFSAFYSRELRGETIPFD------DGMVITKREPV 130 K IT +VGKPI S IEV+R I T +A R + GET+ D + R P Sbjct: 82 KTITDEVGKPITYSRIEVERCIETVTLAAETMRTMHGETVNTDAFASGKKTISFFSRVPC 141 Query: 131 GLVGAITPFNFPLNLFAHKIAPAIAMGNSIVAHPSSKAPMITIELTKIIEKVLKSKKIPL 190 G+V AITPFNFPLNL AHKIAPA+ GN+++ P+ +AP+ + K+ ++S+ Sbjct: 142 GVVVAITPFNFPLNLIAHKIAPALVAGNAVILKPTPEAPLTAYKFAKLF---IESEFAIK 198 Query: 191 GVFNLLTGEGHIVGDEIVKNNKINKLSFTGSVEVGESITKKAGFKKITLELGGNNPMIIL 250 +++ G+ VG +V + +SFTGSV VGE ITK AG KK++LELGGN I Sbjct: 199 DALSVVYGDAD-VGGTLVTSEIPRVISFTGSVGVGEIITKSAGIKKVSLELGGNAATFID 257 Query: 251 KDANINKAVESCMSGKFLNSGQVCISVGRVLIEQEVADEFINKIVEKVKKLKIGNPLDED 310 K AN++ A + C G F+NSGQVCIS+ R+ + +++ EF KI E KKL +G+P +ED Sbjct: 258 KSANLDLAAQRCAIGAFVNSGQVCISLQRIYVHKDIYSEFALKIAEATKKLVVGSPYEED 317 Query: 311 TNISSLISLDSAERVEKLINKSIGQGGKLICGGKRENSIIYPTIL-EITADNILANIEIF 369 T + L++ ++A+R + + +I +G I + E + YP ++ ++ D + E+F Sbjct: 318 TFMGPLVNDEAAKRAMEWVQSAIKEGATPILEPRVEGRVFYPCVMADVKEDMAIVCQEVF 377 Query: 370 APVLPIIRVNDMNEALNQANNSNYGLHSGVFTQDINKALYFADNLEYGGVLINNSPTFRI 429 AP++ +I V D +EAL NNS YGL +FT D+N + L+ GG++IN+ PT R Sbjct: 378 APIVSLIEVKDFDEALPMMNNSPYGLQFSIFTNDLNLTKRAINELDAGGIVINDMPTLRF 437 Query: 430 DNMPFGGIKHSGLGREGIKYAIDEMSEIKTIIV 462 D P+GG+K SG+GREG ++AI+EMSEIK++I+ Sbjct: 438 DIQPYGGVKLSGVGREGPRFAIEEMSEIKSVII 470 Lambda K H 0.316 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 465 Length of database: 471 Length adjustment: 33 Effective length of query: 432 Effective length of database: 438 Effective search space: 189216 Effective search space used: 189216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory