Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_011372945.1 SUDEN_RS06875 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000012965.1:WP_011372945.1 Length = 222 Score = 117 bits (292), Expect = 4e-31 Identities = 72/186 (38%), Positives = 107/186 (57%), Gaps = 8/186 (4%) Query: 15 AVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGERVNDVPPS- 73 +V + I+L+IKEG+ VV G SG GKST+L +IA L + T G++ + G+RV+ +P + Sbjct: 18 SVVALDNINLEIKEGQVVVLRGSSGSGKSTILSLIAALSKPTSGEVLVGGDRVSKLPDNF 77 Query: 74 -----KRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTPYLD 128 + I VFQ Y L P ++V +N+ + S+ EI +++ M + Sbjct: 78 ASDFRRHFIGFVFQKYNLIPTLSVEENIILPLVPMNLSESEIKAKLQRVLRMFNIEHKAS 137 Query: 129 RLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSDTTM 188 +L K LSGG++QRVAI RA NPK+ L DEP +NLD L ++ IEI K + T+ Sbjct: 138 QLVKNLSGGEQQRVAIARANINNPKIILADEPTANLDKKLSLSF-IEIVK-ELKNEGKTI 195 Query: 189 IYVTHD 194 I THD Sbjct: 196 IIATHD 201 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 222 Length adjustment: 26 Effective length of query: 336 Effective length of database: 196 Effective search space: 65856 Effective search space used: 65856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory