Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_011372556.1 SUDEN_RS04860 sulfate/molybdate ABC transporter ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000012965.1:WP_011372556.1 Length = 290 Score = 167 bits (423), Expect = 3e-46 Identities = 87/207 (42%), Positives = 137/207 (66%), Gaps = 11/207 (5%) Query: 22 IDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLLIDNQ------RVNDLPPKDR 75 +D IEDGEF+ G SG GK+TLLR+IAGLE SG + +DN+ R ++PP+ R Sbjct: 21 VDKKIEDGEFLTLFGKSGSGKTTLLRIIAGLEVPESGYIKVDNEVWFDSKRGINIPPQRR 80 Query: 76 SVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEILQLDKLLERKPKDLS 135 +VG VFQ YAL+P+M+V +N+ F L+ DK + K+ V+ + +I+++ L + KP+ LS Sbjct: 81 NVGFVFQDYALFPNMSVEDNLKFALQ----DKNKFKK-VDDILKIMEIQNLSKMKPQHLS 135 Query: 136 GGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQRIRSTMIYVTHDQV 195 GGQ+QRVA+ R ++REPK+ L DEPLS LD+ +R +++ E+ +HQ+ + V+HD Sbjct: 136 GGQKQRVAVARALMREPKILLLDEPLSALDSTMRQKLQDELFFIHQKFGIISLLVSHDIG 195 Query: 196 EAMTLADKIVVLNAGEIAQVGQPLHLY 222 E L+ ++ +++GEI G P ++ Sbjct: 196 EIFRLSSRVFKISSGEITHDGSPSEVF 222 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 290 Length adjustment: 28 Effective length of query: 343 Effective length of database: 262 Effective search space: 89866 Effective search space used: 89866 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory