Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate WP_011371908.1 SUDEN_RS01415 acyl-CoA dehydratase activase
Query= BRENDA::Q8VUG0 (301 letters) >NCBI__GCF_000012965.1:WP_011371908.1 Length = 268 Score = 169 bits (427), Expect = 8e-47 Identities = 96/252 (38%), Positives = 155/252 (61%), Gaps = 4/252 (1%) Query: 41 GIDVGSVSSQAVLVCDG-ELYGYNSMRTGNNSPDSAKNALQGIMDKIGMKLEDINYVVGT 99 GID+GS + + +V + +L G+ +G+ AK AL+ ++D++ + +++ Y V T Sbjct: 6 GIDIGSTAIKIAIVDENRKLVGHKISASGSMFYKYAKQALKEMLDELNIDEKNLVYRVAT 65 Query: 100 GYGRVNVPFAHKAITEIACHARGANYMGGNK--VRTILDMGGQDCKAIHCDDKGKVTNFL 157 GYGR A + I+EI +A GA K ++TI+++GGQD KAI DD+G V NF Sbjct: 66 GYGRKLFKEADENISEITANAMGAMAAADGKCNIKTIINIGGQDSKAISLDDEGNVVNFA 125 Query: 158 MNDKCAAGTGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEALGLLKAG 217 MND+CAAGTG+ ++V++ ++I + ELG F + P A++S C VFA+SE +GLL Sbjct: 126 MNDRCAAGTGKFLDVVAMNLEIEVDELGEYHFKSQGTPLAINSTCAVFAESEIIGLLGND 185 Query: 218 YTKNMVIAAYCQAMAERVVSLLERIGVEEGFFITGGIAKNPGVVKRIERLLGIKQLETKI 277 ++ ++A ++A+R++ LL+R+G+ EG + GG A N G+V IE LG K++ Sbjct: 186 HSVEDIVAGVHYSIAKRIIKLLKRVGINEGIYFDGGPALNSGLVNAIENELG-KKIFIPE 244 Query: 278 DSQIAGALGAAL 289 QI + GAA+ Sbjct: 245 FPQITTSYGAAI 256 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 268 Length adjustment: 26 Effective length of query: 275 Effective length of database: 242 Effective search space: 66550 Effective search space used: 66550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory