Align Phenylacetyl-CoA:acceptor oxidoreductase small subunit PadC (characterized, see rationale)
to candidate WP_011372132.1 SUDEN_RS02600 4Fe-4S dicluster domain-containing protein
Query= uniprot:A0A2R4BLY8 (215 letters) >NCBI__GCF_000012965.1:WP_011372132.1 Length = 212 Score = 126 bits (317), Expect = 3e-34 Identities = 72/208 (34%), Positives = 99/208 (47%), Gaps = 37/208 (17%) Query: 7 VADLRRCVGCQTCTAACKHTNATPPGVQWRWVLDVEAGEFPDVSRTFVPVGCQHCDEPPC 66 + DL C+GC+ C ACK N P V V+ G FP+ RTF P+ C HC+ PC Sbjct: 6 LVDLHLCMGCKGCEIACKVENEVPLSTWRLRVKYVDVGTFPETKRTFTPLRCNHCENAPC 65 Query: 67 ETVCPTTATKKRADGLVTIDYDLCIGCAYCSVACPYNARYKVNFAEPAYGDRLMANEKQR 126 E +CP +A +G+V ID + CIGC+ C +ACPY A Y Sbjct: 66 ERICPVSALHYLENGIVNIDKERCIGCSGCVMACPYGAIY-------------------- 105 Query: 127 ADPARVGVATKCTFCSDRIDYGVAHGLTPGVDPDATPACANACIANALTFGDIDDPNSKA 186 DP + A KCT+C+ R V PAC AC A FGD++DP S Sbjct: 106 IDP-QTQTADKCTYCAHR------------VASSMMPACVVACPVQANIFGDLEDPTSNI 152 Query: 187 SRLLRENE---HFRMHEELGTGPGFFYL 211 S+ ++ ++ R E+ GT P +Y+ Sbjct: 153 SKYIQLHQGGVQVRKPEK-GTNPHHYYV 179 Lambda K H 0.323 0.137 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 212 Length adjustment: 22 Effective length of query: 193 Effective length of database: 190 Effective search space: 36670 Effective search space used: 36670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory