Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate WP_011373231.1 SUDEN_RS08390 3-oxoacyl-ACP reductase FabG
Query= SwissProt::O18404 (255 letters) >NCBI__GCF_000012965.1:WP_011373231.1 Length = 248 Score = 100 bits (250), Expect = 2e-26 Identities = 78/254 (30%), Positives = 115/254 (45%), Gaps = 23/254 (9%) Query: 8 LVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSEK 63 LVTG + G+G A+ LA G V + + + K+ G + + DV+SE+ Sbjct: 9 LVTGSSRGIGAEIAKVLAGYGLKVWINYRSGATEADAIKDAIESNGGRAAVIGFDVSSEE 68 Query: 64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL--EDFQRVININTVGTFN 121 A++T D G L VN AG N +A R+ EDF VIN N + F Sbjct: 69 AFVDAIKTIVDCDGELSYLVNNAGIT--------NDKLALRMKSEDFMSVINANLLSCF- 119 Query: 122 VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLS 181 G A + + + G +VN AS+ G GQ YSASK V+ MT A + + Sbjct: 120 -----VGCREAMKVMRKKKSGSVVNIASIVGETGNAGQTNYSASKGGVIAMTKSFALEAA 174 Query: 182 TQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIY--ENPL 239 + GIR TI PG T M L ++++ IP R G PSE A + + Sbjct: 175 SSGIRYNTITPGFIATEMTDVLSDEIKGSFTSKIPM-GRFGNPSEIAEATAFLLSDHSSY 233 Query: 240 LNGEVIRIDGALRM 253 + GE ++++G + M Sbjct: 234 ITGETLKVNGGMNM 247 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 248 Length adjustment: 24 Effective length of query: 231 Effective length of database: 224 Effective search space: 51744 Effective search space used: 51744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory