Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_011373231.1 SUDEN_RS08390 3-oxoacyl-ACP reductase FabG
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000012965.1:WP_011373231.1 Length = 248 Score = 130 bits (328), Expect = 2e-35 Identities = 89/250 (35%), Positives = 133/250 (53%), Gaps = 20/250 (8%) Query: 15 RLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFER------ 68 + G++ LVTG ++GIG EIA+ LA G +V I N G A + E Sbjct: 2 KFSGKNVLVTGSSRGIGAEIAKVLAGYGLKVWI---NYRSGATEADAIKDAIESNGGRAA 58 Query: 69 ---LNVTDADAVADLARRLPDVD----VLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGV 121 +V+ +A D + + D D LVNNAGI + A +D+ +V++ NL Sbjct: 59 VIGFDVSSEEAFVDAIKTIVDCDGELSYLVNNAGITNDKLALRMKSEDFMSVINANLLSC 118 Query: 122 FWCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASR 181 F CRE + M + G++V+ AS+ G N Q Y+ASK VI +T+S A E AS Sbjct: 119 FVGCREAMKVMRKKKSGSVVNIASIVGETGNAGQTN--YSASKGGVIAMTKSFALEAASS 176 Query: 182 GVRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFV 241 G+R N + PG+ AT +T + + E + ++ + P+GR P EIA A +L SD +S++ Sbjct: 177 GIRYNTITPGFIATEMT--DVLSDEIKGSFTSKIPMGRFGNPSEIAEATAFLLSDHSSYI 234 Query: 242 TGHTLVVDGG 251 TG TL V+GG Sbjct: 235 TGETLKVNGG 244 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 248 Length adjustment: 24 Effective length of query: 231 Effective length of database: 224 Effective search space: 51744 Effective search space used: 51744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory