Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate WP_011913471.1 PST_RS11845 cystine ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_03050 (229 letters) >NCBI__GCF_000013785.1:WP_011913471.1 Length = 222 Score = 114 bits (285), Expect = 2e-30 Identities = 76/214 (35%), Positives = 112/214 (52%), Gaps = 18/214 (8%) Query: 9 ILDGAWLTLQLALSSMALAIVLGLIGVALRLS---PIRWLARLGDLYSTVIRGIPDLVLI 65 +L GAW T+ L+LS M ++LG LRL P++WLAR+ Y + RG P LV + Sbjct: 16 LLKGAWWTVVLSLSGMFFGLLLGFGLALLRLYAFWPLQWLARV---YVSFFRGTPLLVQL 72 Query: 66 LLIFYGGQDLLNRVAPLLGYDDYIDLNPLVAGIGTLGFIFGAYLSETFRGAFMAIPKGQA 125 +I+YG P LG I L+PL A + AY +E R A +I +GQ Sbjct: 73 FMIYYG--------LPQLG----IQLDPLPAALIGFSLNMAAYTAEILRAAIASIDRGQW 120 Query: 126 EAGAAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAA 185 EA A+ GM Q +R ++PQ R A+P N+++ L K TAL + + + ++ +A+ Sbjct: 121 EAAASIGMGRAQTLYRAILPQAARTALPPLGNSFISLVKDTALAATIQVPELFRQAQLIT 180 Query: 186 DATREPFTFFLAVAAMYLVITSVSLLALRHLEKR 219 T E FT +LA A +Y ++ SV LE R Sbjct: 181 ARTFEIFTMYLAAALIYWLLASVLAYFQGRLEHR 214 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 222 Length adjustment: 22 Effective length of query: 207 Effective length of database: 200 Effective search space: 41400 Effective search space used: 41400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory