Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_011911265.1 PST_RS00075 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_000013785.1:WP_011911265.1 Length = 279 Score = 219 bits (558), Expect = 5e-62 Identities = 129/274 (47%), Positives = 177/274 (64%), Gaps = 15/274 (5%) Query: 2 NQSAQALAAYPVDEPVAQPVTAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGAS 61 N +A A AA AQP+ ++ + KRYGE VL+G+ L+ ++G+ +++IG S Sbjct: 12 NTAAMAAAA------PAQPM-----VRFASVTKRYGELTVLEGLDLDVQEGEKVAIIGPS 60 Query: 62 GSGKSTMLRCINFLEQPDAGVITLDGISI-EMRQGRAGTRAPHQDQLQNLRTRLAMVFQH 120 GSGKST+LR + LE D G+I +DG + M G + L+ +R ++ MVFQ Sbjct: 61 GSGKSTLLRVLMTLEGIDDGLIEVDGEPLTHMPDGHGRLVPANARHLRRVRGKVGMVFQS 120 Query: 121 FNLWSHMTVLENITMAPRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQR 180 FNL+ HM L+N+ AP +VL +S EA +RA L VGL ++ + +PA LSGGQQQR Sbjct: 121 FNLFPHMNALQNVMEAPVQVLGLSKREARERAEELLAMVGLEDKL-EHFPAQLSGGQQQR 179 Query: 181 VAIARALAMEPEIILFDEPTSALDPELVGEVLKVIQTLAE-EGRTMLMVTHEMGFARQVS 239 VAIARALAM P+++LFDE TSALDPEL GEVL VI+ L E TMLMVTH+MGFAR+ + Sbjct: 180 VAIARALAMRPKVMLFDEVTSALDPELCGEVLSVIRRLGEAHNLTMLMVTHQMGFAREFA 239 Query: 240 SQVLFLHQGRVEEHGDA-RILDQPNSERLQQFLS 272 +V F HQGR+ E G + + P +R ++FLS Sbjct: 240 DRVCFFHQGRIHEQGSPDALFNNPQEDRTREFLS 273 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 279 Length adjustment: 25 Effective length of query: 251 Effective length of database: 254 Effective search space: 63754 Effective search space used: 63754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory