Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_011913323.1 PST_RS11065 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000013785.1:WP_011913323.1 Length = 371 Score = 320 bits (819), Expect = 5e-92 Identities = 179/361 (49%), Positives = 243/361 (67%), Gaps = 12/361 (3%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 MADLK+ ++K + +++ I+LDI+ E +VFVGPSGCGKSTLLR+IAGLE+++ G + Sbjct: 1 MADLKIHNLKKGFDGNEIIKGIDLDIRDREFVVFVGPSGCGKSTLLRLIAGLEEVSSGRI 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 E+DG + DV PA+R +AMVFQ+YALYPHMTVR+NMSFAL +A + E+ +EAAA Sbjct: 61 ELDGRDITDVSPAKRDLAMVFQTYALYPHMTVRKNMSFALDLAGADKQEVARKIEAAART 120 Query: 121 LQLGQYLDRLPKALSGGQRQRV----AIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEI 176 L+L L+R P+ LSGGQRQRV AIGR+IVR+PKV+LFDEPLSNLDAALRV RLE+ Sbjct: 121 LELEPLLERKPRQLSGGQRQRVAIGRAIGRAIVRNPKVFLFDEPLSNLDAALRVQMRLEL 180 Query: 177 AQLKEAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIG 236 ++L + + ++TM+YVTHDQVEAMTLA ++VVL GG I QVGSP+ELY P N FVA F+G Sbjct: 181 SRLHQEL-QATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPMELYHHPANLFVAGFLG 239 Query: 237 SPKMNLLPG---KIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAP 293 +PKM L G ++ +G + VE+ G R G V +G+RPE + + Sbjct: 240 TPKMGFLKGHASRVEASGCE--VELDAGCRLFLPVSGATLKAGDPVTLGIRPEHLNRGSE 297 Query: 294 GGDYVFEGKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHV 353 G+ K ++E LG T + +GE T+ +++G G+ LT E A H+ Sbjct: 298 -GNCQLTVKADVSERLGSDTYCHVVTRNGEQLTM-RIRGDFTPRYGESLSLTLEAAHCHL 355 Query: 354 F 354 F Sbjct: 356 F 356 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 371 Length adjustment: 30 Effective length of query: 343 Effective length of database: 341 Effective search space: 116963 Effective search space used: 116963 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory