Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_011914858.1 PST_RS19170 branched-chain-amino-acid transaminase
Query= reanno::psRCH2:GFF445 (307 letters) >NCBI__GCF_000013785.1:WP_011914858.1 Length = 307 Score = 596 bits (1537), Expect = e-175 Identities = 295/307 (96%), Positives = 301/307 (98%) Query: 1 MSMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYNTPDGTAIFRLQAHTD 60 MSMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYNTP GTAIFRLQAHTD Sbjct: 1 MSMADRDGVIWYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYNTPAGTAIFRLQAHTD 60 Query: 61 RLFDSAHIMNMPMPYSKEEINEATRAAVRENNLESAYIRPMVFYGSEGMGLRASGLKVHV 120 RLFDSAHIMNM +PYSK+EINEATRAAVREN LESAYIRPMVFYGSEGMGLRA+GLKVHV Sbjct: 61 RLFDSAHIMNMQIPYSKDEINEATRAAVRENELESAYIRPMVFYGSEGMGLRAAGLKVHV 120 Query: 121 IVAAWHWGAYMGDEALELGIKVRTSSFTRHHVNITMTRAKSNGAYINSMLALQEAISGGA 180 IVAAWHWGAYMGDEALELGIKVRTSSFTRHHVNITMTRAKSNGAYINSMLALQEAISGGA Sbjct: 121 IVAAWHWGAYMGDEALELGIKVRTSSFTRHHVNITMTRAKSNGAYINSMLALQEAISGGA 180 Query: 181 DEALMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRGTVLTLAAEHGLKIVEKR 240 DEALMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRGTVLTLA E GLK+VEKR Sbjct: 181 DEALMLDPEGYVAEGSGENIFIIKDGVIYTPEVTACLNGITRGTVLTLAGELGLKVVEKR 240 Query: 241 ITRDEVYIADEAFFTGTAAEVTPIREVDGRAIGIGRRGPITEKLQKAYFDLVTGKTDAHA 300 ITRDEVYIADEAFFTGTAAEVTPIREVDGRAIGIGRRGPITE+LQKAYFDLV+GKTD HA Sbjct: 241 ITRDEVYIADEAFFTGTAAEVTPIREVDGRAIGIGRRGPITERLQKAYFDLVSGKTDTHA 300 Query: 301 EWRTLVK 307 EWRTLVK Sbjct: 301 EWRTLVK 307 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_011914858.1 PST_RS19170 (branched-chain-amino-acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01122.hmm # target sequence database: /tmp/gapView.2603769.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-146 473.3 0.5 1.6e-146 473.1 0.5 1.0 1 NCBI__GCF_000013785.1:WP_011914858.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000013785.1:WP_011914858.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 473.1 0.5 1.6e-146 1.6e-146 1 298 [] 11 306 .. 11 306 .. 0.99 Alignments for each domain: == domain 1 score: 473.1 bits; conditional E-value: 1.6e-146 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvev 73 w+dGelv+++da++hvlth+lhYG+gvfeG+RaY+t+ g+aifrl+ h++Rl+dsa+i++++ipysk+e++e+ NCBI__GCF_000013785.1:WP_011914858.1 11 WYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYNTPAGTAIFRLQAHTDRLFDSAHIMNMQIPYSKDEINEA 83 9************************************************************************ PP TIGR01122 74 tkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsi 146 t+ ++r+n+l+saYiRp+v++G+e++gl++ ++lkv+vi+aaw+wgay+g+eale Gikv++ssf+r++vn+ NCBI__GCF_000013785.1:WP_011914858.1 84 TRAAVRENELESAYIRPMVFYGSEGMGLRA-AGLKVHVIVAAWHWGAYMGDEALELGIKVRTSSFTRHHVNIT 155 ******************************.9***************************************** PP TIGR01122 147 ptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdavik 219 +t+ak++g+Y+ns+la +ea++ G+dea++Ld eGyvaeGsGenifi+kdgv++tP+v +++L+gitr +v++ NCBI__GCF_000013785.1:WP_011914858.1 156 MTRAKSNGAYINSMLALQEAISGGADEALMLDPEGYVAEGSGENIFIIKDGVIYTPEV-TACLNGITRGTVLT 227 **********************************************************.78************ PP TIGR01122 220 lakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegktekke 292 la elg++v+e+ri+r+e+y+aDe+f+tGtaaevtPirevDgr ig g+rGp+t++lq+a+fdlv+gkt++++ NCBI__GCF_000013785.1:WP_011914858.1 228 LAGELGLKVVEKRITRDEVYIADEAFFTGTAAEVTPIREVDGRAIGIGRRGPITERLQKAYFDLVSGKTDTHA 300 ************************************************************************* PP TIGR01122 293 ewltyv 298 ew t v NCBI__GCF_000013785.1:WP_011914858.1 301 EWRTLV 306 **9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 12.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory