Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (subunit 1/2) (EC 1.3.8.1) (characterized)
to candidate WP_011913066.1 PST_RS09725 acyl-CoA dehydrogenase family protein
Query= BRENDA::D2RL84 (383 letters) >NCBI__GCF_000013785.1:WP_011913066.1 Length = 383 Score = 340 bits (873), Expect = 3e-98 Identities = 174/376 (46%), Positives = 249/376 (66%) Query: 2 DFNLTEDQQMIKDMAAEFAEKFLAPTVEERDKAHIWDRKLIDKMGEAGFCGICFPEEYGG 61 D L+EDQ+MI+DMA +FA + +AP + +KA D L+ +MGE G G+ PEE+GG Sbjct: 3 DLELSEDQRMIRDMARDFARREIAPHAQAWEKAGWIDDALVAQMGELGLLGMVVPEEWGG 62 Query: 62 MGLDVLSYILAVEELSKVDDGTGITLSANVSLCATPIYMFGTEEQKQKYLAPIAEGTHVG 121 +D ++Y LAVEE+S D TG +S + S+ P+ +G++ QK ++LA +A G +G Sbjct: 63 SYIDYVAYALAVEEISAGDGATGALMSIHNSVGCGPVLNYGSQAQKDEWLAELASGRAIG 122 Query: 122 AFGLTEPSAGTDASAQQTTAVLKGDKYILNGSKIFITNGKEADTYVVFAMTDKSQGVHGI 181 F LTEP AG++A +T A L +++LNGSK F +N K A +VFA+TD G G+ Sbjct: 123 CFALTEPQAGSEAHNLRTRAELVDGQWVLNGSKQFCSNAKRAKLAIVFAVTDPDLGKKGL 182 Query: 182 SAFILEKGMPGFRFGKIEDKMGGHTSITAELIFEDCEVPKENLLGKEGEGFKIAMETLDG 241 SAF++ GF + E KMG S T + DC +P+ NLLG+ G+G IA+ L+G Sbjct: 183 SAFLVPTDTAGFAVERSEHKMGIRASDTCAVSLSDCRIPQANLLGERGKGLAIALSNLEG 242 Query: 242 GRIGVAAQALGIAEGALAAAVKYSKEREQFGRSISKFQALQFMMADMATKIEAARYLVYH 301 GRIG+ AQALGIA A AA+ Y++ER QFG+ I++ Q++ M+ADM T++ AAR L+ H Sbjct: 243 GRIGIGAQALGIARAAFEAALLYARERVQFGKPIAEHQSIANMLADMQTQLNAARLLILH 302 Query: 302 AAMLKNEGKPYSEAAAMAKCFASDVAMEVTTDAVQIFGGYGYTVDYPAERYMRNAKITQI 361 AA LK+ G P A+ AK FAS++A +V + AVQI GGYGY DYP ERY R+A+ITQI Sbjct: 303 AARLKSAGLPCLSEASQAKLFASEMAEKVCSQAVQIHGGYGYLEDYPVERYYRDARITQI 362 Query: 362 YEGTNQVMRIVTSRAL 377 YEG++++ R++ +R L Sbjct: 363 YEGSSEIQRLLIAREL 378 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 383 Length adjustment: 30 Effective length of query: 353 Effective length of database: 353 Effective search space: 124609 Effective search space used: 124609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory