Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_011913714.1 PST_RS13060 FAD-binding protein
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_000013785.1:WP_011913714.1 Length = 309 Score = 161 bits (408), Expect = 2e-44 Identities = 116/323 (35%), Positives = 171/323 (52%), Gaps = 26/323 (8%) Query: 4 VLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHY-GADEVI 62 +LV+ E V+ +L + A I D + L+ GS + + A G +V+ Sbjct: 3 ILVIAEHNNAVLAAATLNTVAAAKAIGGD----IHVLVAGSGCGAIGEAAAQIEGVAKVL 58 Query: 63 VVDDEALAVYTTE-PYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCT 121 V DD A YT + P A A A + VL AT+ G++ PRV+A++ ++ Sbjct: 59 VADD---AAYTNQLPENVAPLIADLAKNYSHVLAAATTNGKNFLPRVAAQLDVDQISEII 115 Query: 122 GLAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFK 181 + + K RP + GN +AT+ Q S + ++ + A Sbjct: 116 SVESPDTFK-----RPIYAGNAIATV-------QSSAPIKVITVRSTGFDAVNATGGSAA 163 Query: 182 VE----FNDADKLVQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGG 237 VE DA K V + + ++ + ++ AKI+VS GRGM +N LY LA+ +G Sbjct: 164 VEQISGTGDAGKSAFVGEELAKSDRP-ELTAAKIVVSGGRGMQNGDNFKHLYSLADKLGA 222 Query: 238 EVSGSRATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNP 297 V SRA +DAG++ QVGQTGK V P LYIA GISGAIQH+AGM+D++ IVAINK+ Sbjct: 223 AVGASRAAVDAGFVPNDMQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDE 282 Query: 298 EAPIFKYADVGIVGDVHKVLPEL 320 EAPIF+ AD G+VGD+ +++PEL Sbjct: 283 EAPIFQVADYGLVGDLFEIIPEL 305 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 309 Length adjustment: 28 Effective length of query: 308 Effective length of database: 281 Effective search space: 86548 Effective search space used: 86548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory