Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_011913553.1 PST_RS12255 carbohydrate ABC transporter permease
Query= reanno::psRCH2:GFF851 (296 letters) >NCBI__GCF_000013785.1:WP_011913553.1 Length = 280 Score = 95.1 bits (235), Expect = 2e-24 Identities = 91/294 (30%), Positives = 136/294 (46%), Gaps = 44/294 (14%) Query: 17 HAALLAFVAAILFPLLMVISISFREG-NFATGSL--FPENPTLEHWSLALGIPYTHADGS 73 HA LL A L PL++++ SF+ + TG+L +PE T W A A G Sbjct: 17 HATLLLACAVYLVPLIVMLLTSFKTPEDIRTGNLLSWPEAFTAMGWLTAWD-----AVGG 71 Query: 74 VTQPPFPVLLWLWNSVKIAFVSSILILLLSTTSAYAFARMRFGGKAPILKSMLIFQMFPP 133 + WNSVKI + ++ L + Y + RF G + + +L+F F P Sbjct: 72 ----------YFWNSVKIVIPAVLISTALGAINGYVLSMWRFRG-SQLFFGLLLFGCFLP 120 Query: 134 --VLSLVAIYALFDQLGQHVSWLGVNSHGAVIVASLGGMALHIWTIKGYFESIDASLEEA 191 V+ L A + L +LG L + G V+V + G+A + ++ S+ +L A Sbjct: 121 FQVILLPASFTL-GKLG-----LANTTTGLVLVHVVYGLAFTTLFFRNFYVSVPEALVRA 174 Query: 192 AIVDGATTWQAFFHILLPMSVPILAVVFILAFITSVTEYPIASVLLM-DVDKLTL----- 245 A +DGA + F ILLPMSVPI+ V I F ++ V D +T+ Sbjct: 175 ARLDGAGFFTIFGRILLPMSVPIIMVCLIWQFTQIWNDFLFGVVFASGDTQPVTVALNNL 234 Query: 246 ---SVGAQQYLYPQNYLWGDFAAAAVLSGLPITAVFLYCQKWIVGGLTAGGVKG 296 S GA+QY AAA+++GLP V++ K+ + GLTAG VKG Sbjct: 235 VNTSTGAKQYNVDM--------AAAMIAGLPTLVVYVIAGKYFLRGLTAGAVKG 280 Lambda K H 0.327 0.139 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 280 Length adjustment: 26 Effective length of query: 270 Effective length of database: 254 Effective search space: 68580 Effective search space used: 68580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory