Align ABC transporter for D-mannitol and D-mannose, ATPase component (characterized)
to candidate WP_011913323.1 PST_RS11065 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::pseudo3_N2E3:AO353_25895 (367 letters) >NCBI__GCF_000013785.1:WP_011913323.1 Length = 371 Score = 573 bits (1478), Expect = e-168 Identities = 292/371 (78%), Positives = 321/371 (86%), Gaps = 4/371 (1%) Query: 1 MAHLKIKNLQKGFEGFSIIKGIDLEVNDREFVVFVGPSGCGKSTLLRLIAGLEEVTAGTI 60 MA LKI NL+KGF+G IIKGIDL++ DREFVVFVGPSGCGKSTLLRLIAGLEEV++G I Sbjct: 1 MADLKIHNLKKGFDGNEIIKGIDLDIRDREFVVFVGPSGCGKSTLLRLIAGLEEVSSGRI 60 Query: 61 ELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVNKAEVEKKVNEAARI 120 ELDGRDIT+VSPAKRDLAMVFQTYALYPHM+VRKNMSFALDLAG +K EV +K+ AAR Sbjct: 61 ELDGRDITDVSPAKRDLAMVFQTYALYPHMTVRKNMSFALDLAGADKQEVARKIEAAART 120 Query: 121 LELGPMLERKPKQLSGGQRQRVAIGRAI----VRNPKIFLFDEPLSNLDAALRVQMRLEL 176 LEL P+LERKP+QLSGGQRQRVAIGRAI VRNPK+FLFDEPLSNLDAALRVQMRLEL Sbjct: 121 LELEPLLERKPRQLSGGQRQRVAIGRAIGRAIVRNPKVFLFDEPLSNLDAALRVQMRLEL 180 Query: 177 ARLHKELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPLELYHQPANLFVAGFLGT 236 +RLH+ELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSP+ELYH PANLFVAGFLGT Sbjct: 181 SRLHQELQATMIYVTHDQVEAMTLADKVVVLNGGRIEQVGSPMELYHHPANLFVAGFLGT 240 Query: 237 PKMGFLKGKVTRVERQNCEVLLDAGTRITLPLSGANLSIGGAVTLGIRPEHLNLALPGDC 296 PKMGFLKG +RVE CEV LDAG R+ LP+SGA L G VTLGIRPEHLN G+C Sbjct: 241 PKMGFLKGHASRVEASGCEVELDAGCRLFLPVSGATLKAGDPVTLGIRPEHLNRGSEGNC 300 Query: 297 TLQVTADVSERLGSDTFCHVLTASGEALTMRIRGDLASRYGEQLSLHLDAEHCHLFDANG 356 L V ADVSERLGSDT+CHV+T +GE LTMRIRGD RYGE LSL L+A HCHLFD++G Sbjct: 301 QLTVKADVSERLGSDTYCHVVTRNGEQLTMRIRGDFTPRYGESLSLTLEAAHCHLFDSSG 360 Query: 357 VAVARPLRAAA 367 AV +PL+ A Sbjct: 361 QAVGQPLQQVA 371 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 371 Length adjustment: 30 Effective length of query: 337 Effective length of database: 341 Effective search space: 114917 Effective search space used: 114917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory