Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate WP_011911348.1 PST_RS00510 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein
Query= BRENDA::O87873 (258 letters) >NCBI__GCF_000013785.1:WP_011911348.1 Length = 701 Score = 75.5 bits (184), Expect = 3e-18 Identities = 56/173 (32%), Positives = 83/173 (47%), Gaps = 6/173 (3%) Query: 12 LERDGSLLRLRLARPKANIVDAAMIAAMRQALGEHLQAPALRAVLLDAEGPHFSFGASVD 71 LER G + + + P N + A+ + A + +AP + AV+L EGP F GA + Sbjct: 7 LERRGDIALILVNNPPVNALGHAVRKGLLDAFRQADEAPEVTAVVLVCEGPTFMAGADIK 66 Query: 72 EH-MPDQCAQMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAAPDAKFG 130 E P Q SL ++ + P + + G LGGGLEVA + A DAK G Sbjct: 67 EFGKPPQAP----SLPEVIEVIEGCRKPSVAVIHGSALGGGLEVALGCHYRIARSDAKVG 122 Query: 131 QPEIRLGVFAPAASCLLPPRV-GQACAEDLLWSGRSIDGAEGHRIGLIDVLAE 182 PE++LG+ A PR+ G A +++ SG+ I AE ++D L E Sbjct: 123 LPEVKLGLLPGAGGTQRLPRLAGVEKALEMIVSGQPIGAAEALEHHIVDELFE 175 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 701 Length adjustment: 32 Effective length of query: 226 Effective length of database: 669 Effective search space: 151194 Effective search space used: 151194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory