Align BadK (characterized)
to candidate WP_011911840.1 PST_RS03120 enoyl-CoA hydratase/isomerase family protein
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000013785.1:WP_011911840.1 Length = 261 Score = 152 bits (385), Expect = 5e-42 Identities = 99/261 (37%), Positives = 139/261 (53%), Gaps = 3/261 (1%) Query: 1 MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA 60 MS +L ET G V +TLNRP +N+LN A++ L L A+D + +++ G A Sbjct: 1 MSEAVLLFETLGPVARLTLNRPKAMNSLNLAMLAELEQRLAEIAANDELRTVILTGAGPA 60 Query: 61 FAAGADIASMAAWSYSDVYGSNFITRNWETIRQIR---KPVLAAVAGLAYGGGCELALAC 117 F AGAD+ + A + ++F+ R + Q+R KPV+AA+ G+ GG ELA+ Sbjct: 61 FCAGADLKEVLAGASLAAGEADFLDRANQVFGQLRNLPKPVIAALNGVTMAGGLELAMCA 120 Query: 118 DIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLV 177 DIV+A SA A G+ PGAGG LPR I AM + L+ + L+A E GLV Sbjct: 121 DIVVAADSATIADAHANFGVYPGAGGAAILPRLIPLNMAMYLLLTGKSLSASEMKACGLV 180 Query: 178 SRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFAS 237 V D L + ++LA IA S AL +KE + + T + +L E+ L S Sbjct: 181 CEVHADAELAEAALSLAKQIAKKSPIALRRMKEVARASADKTRDDALLHEQVMLRQHLRS 240 Query: 238 ADAREGIQAFLEKRAPCFSHR 258 AD +EG+ AF EKRAP F R Sbjct: 241 ADLQEGLHAFNEKRAPQFKGR 261 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory